Welcome to Dirty Paws!                    

We specialise in grooming dogs and cats and have over 17 years experience in the trade. Based in Greenwich Market, South East London, we promise to pamper your pet and make them look even more gorgeous and lovable than they already are!

beautiful groomed pets!

What is on offer for your pet...
Using the latest high-tech equipment and catering for all breeds, Dirty Paws offers the complete grooming service.
Only the best quality shampoos and conditioners are used, and these are especially chosen to suit an individual pet's skin, hair, or lifestyle needs. A complete grooming includes a warm bath, blow-dry, trimmed per breed and /or owner specifications, nails trimmed and ears cleaned as required. For your Feline loved ones, we also offer grooming services which include bathing in Aloe Silk Protein Shampoo (BEAUTIFUL on long haired coats!), conditioning, nail trims, and dematting as necessary. This is always done by special appointment on dog-less days.

Together with feeding, exercising, and regular vet check-ups, grooming your dog is an essential part of keeping him healthy and happy. The amount of time and effort required to groom in between salon visits depends on the breed, type and length of coat as well as the dog's lifestyle. Salon visits do not eliminate the need to care for your dog's coat and skin at home, but they can help minimise the time required for home grooming.
Trimming of the nails and coat and other hygienic treatments may not be practical to do at home. Fortunately, that's our specialty.                  

Not only do we bathe away dirt, debris and odours from the dog's coat, but we also trim, thin, brush and fluff it as necessary. We inspect your dog from the end of his nose to the tip of his wagging tail. Of course we are not a vet, but we can sometimes help point out something that may need a vet's attention
that a busy pet owner sometimes doesn't spot.

 

 

                            dirtypawsprintvsmalldirtypawsprintvsmalldirtypawsprintvsmalldirtypawsprintvsmalldirtypawsprintvsmalldirtypawsprintvsmalldirtypawsprintvsmalldirtypawsprintvsmall

 

 

 

 

© 2008 Dirty Paws. All rights reserved.

  Site Map